DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:287 Identity:83/287 - (28%)
Similarity:133/287 - (46%) Gaps:45/287 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLIVATHSGITQSQI-GQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVC 71
            ||::.....::..|: |:|..|.:     |:||||...|....|:.||::.|        .||.|
Zfish    10 LLLMYVRDSLSNLQVCGRPNPTLN-----PRIVGGVNATHGAWPWMVSLQGR--------YGHFC 61

  Fly    72 GGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNG 136
            ||::|:.:.|.:||||....|...::....:....||..::|.||        ::.|:.|..|:.
Zfish    62 GGSLINNQWVLTAAHCIVDQTPSSIIVYLGKWRSYVADVNSISRT--------IRHIIPHPSYSN 118

  Fly   137 STLENDIALLFLNGFIPWESPGVRAIPLAIKAPE--EGTTCLIHGWGKVTM-------------- 185
            .|.:||||||.|...:.: :..::.|.||.:...  .||...:.|||.:.:              
Zfish   119 ITKDNDIALLQLTSTVQY-TDYIKPICLADENSNFPRGTNSWVAGWGDIGVLGTGGIRGRTTVSV 182

  Fly   186 -KEKSASLQQAPVPILNKELCQVIY--KLPASQMCAGFLQGGIDACQGDSGGPLICDGRL---AG 244
             ......||:|.:.:.:...|..|.  ::..:.:|||...||.....|||||||:....:   ||
Zfish   183 PLPHPGILQEAELKVYSNADCNNICHGRITPNMICAGTRPGGKATFSGDSGGPLMTKCSVWVQAG 247

  Fly   245 IISWGVGCADPGYPGVYTNVSHFLKWI 271
            ::|.|.|||.|..|.|:..||.:.:||
Zfish   248 VLSHGYGCAQPNLPEVFIRVSEYKQWI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 74/255 (29%)
Tryp_SPc 38..273 CDD:238113 76/256 (30%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.