DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and tmprss5

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:260 Identity:96/260 - (36%)
Similarity:154/260 - (59%) Gaps:47/260 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYR 99
            ||:|:||....:.:.|:|||:        :|...|:|||::|:.:.:.:||||  ::.     ||
Zfish   309 LPRIIGGVEAALGRWPWQVSL--------YYNNRHICGGSIITNQWIVTAAHC--VHN-----YR 358

  Fly   100 DPEL--YVVVAG--SSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVR 160
            .|::  :||.||  :|.:.:..:: |.:.|:||:.:|:||..|.:|||||:.|...:.: |..:|
Zfish   359 LPQVPSWVVYAGIITSNLAKLAQY-QGFAVERIIYNKNYNHRTHDNDIALVKLKTPLNF-SDTIR 421

  Fly   161 AIPLAIKAPE------EGTTCLIHGWG-----KVTMKEKSASLQQAPVPILNKELC--QVIY--K 210
            .:.|    |:      .||.|.|.|||     .|.:.|   .|::||||:::.:.|  ..:|  :
Zfish   422 PVCL----PQYDHDLPGGTQCWISGWGYTQPDDVLIPE---VLKEAPVPLISTKKCNSSCMYNGE 479

  Fly   211 LPASQMCAGFLQGGIDACQGDSGGPLICDG----RLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            :.:..:|||:.:|.:|||||||||||:|..    ||.|::|||.|||:|.:||||:.|:.||.||
Zfish   480 ITSRMLCAGYSEGKVDACQGDSGGPLVCQDENVWRLVGVVSWGTGCAEPNHPGVYSKVAEFLGWI 544

  Fly   272  271
            Zfish   545  544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 92/256 (36%)
Tryp_SPc 38..273 CDD:238113 94/257 (37%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133
Tryp_SPc 311..544 CDD:214473 92/256 (36%)
Tryp_SPc 312..547 CDD:238113 94/257 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.