DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and hpn

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001091657.2 Gene:hpn / 569259 ZFINID:ZDB-GENE-141212-373 Length:425 Species:Danio rerio


Alignment Length:267 Identity:90/267 - (33%)
Similarity:128/267 - (47%) Gaps:44/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ILP--KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPL 96
            :||  :||||........|:|||::...:|:        |||::||.|.:.|||||:      |.
Zfish   158 MLPEERIVGGVDARQGSWPWQVSLQYDGVHQ--------CGGSIISDRWIISAAHCF------PE 208

  Fly    97 VYRDPELYVVVAGS--SAIDRTDRFTQEYLVQRIVGHKDY------NGSTLENDIALLFLN---G 150
            .||....:.|:.||  :...|.:....|  |:.:|.|..|      |......|||::.|.   .
Zfish   209 RYRHASRWRVLMGSIYNTPIRKNVVIAE--VKTVVYHSSYLPFVDANIDDNSRDIAVISLTKPLQ 271

  Fly   151 FIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSAS-LQQAPVPILNKELCQ----VIYK 210
            |..:..|  ..:|...:...:|....:.|||.|......|: ||:|.|||::..:|.    ...:
Zfish   272 FTDYIQP--VCLPTYGQRLADGQMGTVTGWGNVEYYGTQANVLQEAHVPIISDAVCNGPDYYDNQ 334

  Fly   211 LPASQMCAGFLQGGIDACQGDSGGPLICDG--------RLAGIISWGVGCADPGYPGVYTNVSHF 267
            :..:..|||:.:||.|:||||||||.:...        ||.|::|||.|||....|||||.||.|
Zfish   335 VTTTMFCAGYEKGGTDSCQGDSGGPFVAADVLSKTSRYRLLGVVSWGTGCAMAKKPGVYTRVSRF 399

  Fly   268 LKWIRRA 274
            |.||..|
Zfish   400 LPWISTA 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 85/257 (33%)
Tryp_SPc 38..273 CDD:238113 87/258 (34%)
hpnNP_001091657.2 SRCR_2 54..160 CDD:321960 0/1 (0%)
Tryp_SPc 164..404 CDD:238113 86/257 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.