DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP011918

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_001689276.1 Gene:AgaP_AGAP011918 / 5667954 VectorBaseID:AGAP011918 Length:259 Species:Anopheles gambiae


Alignment Length:243 Identity:77/243 - (31%)
Similarity:112/243 - (46%) Gaps:29/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :||.|......|.|:|||:...:..       |.||||:|....:.:||||        |..|.|
Mosquito    31 RIVNGLNAVSGQFPYQVSLTSATYQ-------HFCGGAIIGNHWILTAAHC--------LTGRKP 80

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAI 166
            ...:.|.|:..   :.|....|.|::.:.|.::|..|.:|||||:.....|.:.: .|..:.:|.
Mosquito    81 AEVIAVVGALT---SARGGYNYDVEQFILHPNFNEWTQQNDIALVRTKWSISFNT-AVFPVKMAR 141

  Fly   167 KAPEEGTTCLIHGWGKVTMK--EKSASLQQAPVPILNKELCQVIYK------LPASQMCAGFLQG 223
            .........|..|||..|:.  :.:..||...:..::.|.|...::      :..|.:|. |.:.
Mosquito   142 TYTPANRAVLASGWGLTTLSVPKPADRLQYVALRTISNEDCSERFRKLQNRAITPSILCT-FSRN 205

  Fly   224 GIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
            ....|.|||||||:.||.|.||:|||:.|| .|||.||..||.|..||
Mosquito   206 EQGTCMGDSGGPLVEDGELVGIVSWGIPCA-VGYPDVYVRVSSFRAWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 75/241 (31%)
Tryp_SPc 38..273 CDD:238113 77/242 (32%)
AgaP_AGAP011918XP_001689276.1 Tryp_SPc 31..252 CDD:214473 75/241 (31%)
Tryp_SPc 32..252 CDD:238113 75/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.