DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP001245

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_001689377.2 Gene:AgaP_AGAP001245 / 5667668 VectorBaseID:AGAP001245 Length:272 Species:Anopheles gambiae


Alignment Length:259 Identity:81/259 - (31%)
Similarity:121/259 - (46%) Gaps:52/259 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VILP----KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTS 93
            |.||    :|.||....|...|:|:|:||.|         |.||.:|||.....|||||   ...
Mosquito    40 VELPPFQGRIFGGVEADIANYPYQLSLRRAS---------HSCGASVISANWALSAAHC---TFP 92

  Fly    94 VPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPG 158
            ||.    |.:..:..|||  |||.... .:.|::|:.|..|:...|.||:.:|...      :| 
Mosquito    93 VPA----PGVITLQGGSS--DRTSGGV-VFQVEQIINHPQYDDWNLVNDVCVLRTT------TP- 143

  Fly   159 VRAIPLAIKAPEE-------GTTCLIHGWGKVTMKEKSASLQQAPVPILNKELCQVIYK---LPA 213
            :..:.:||.|.:.       |:..::.|||.:......|.|::..:|::::..|:..:.   :..
Mosquito   144 LSGVNIAIIALDPVGATHAVGSRAVLSGWGLMEGSVLPAILRRVDIPVVDQGACETAWGSGWVTP 208

  Fly   214 SQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWG----VGCADPGYPGVYTNVSHFL--KWI 271
            ..:||.  :.|.|||.|||||||:..|:..||:|||    ||..    |||:..|:..|  .||
Mosquito   209 DMICAS--EPGRDACNGDSGGPLVVGGQQIGIVSWGDTQCVGTR----PGVFARVAFPLIRNWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 76/249 (31%)
Tryp_SPc 38..273 CDD:238113 78/250 (31%)
AgaP_AGAP001245XP_001689377.2 Tryp_SPc 48..266 CDD:214473 76/249 (31%)
Tryp_SPc 49..269 CDD:238113 78/250 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.