DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP001247

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_001689376.2 Gene:AgaP_AGAP001247 / 5667666 VectorBaseID:AGAP001247 Length:253 Species:Anopheles gambiae


Alignment Length:281 Identity:87/281 - (30%)
Similarity:132/281 - (46%) Gaps:57/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QIGQPTATASPFV--ILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCS 83
            |:.:||    |..  :..:|.||....|...|.|:|:||..        .|:||.:|:...:..:
Mosquito     2 QVRRPT----PIEVRVTGRIFGGMETNIKDAPHQLSLRRFD--------SHICGASVVDASLAIT 54

  Fly    84 AAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQ------RIVGHKDYNGSTLEND 142
            ||||.   |..|    .||...::.||:  :|||     |.|.      .::.|..||.:|..||
Mosquito    55 AAHCL---TPKP----PPEFITLMGGST--NRTD-----YDVGVIFNAIELIIHPGYNSNTFHND 105

  Fly   143 IALLFLNG-FIPWESPGVRAIPLAIK----APEEGTTCLIHGWGKVTMKEKSAS--LQQAPVPIL 200
            :||:.:.| |..:|:  |..|||..:    :......|.:.|||...|......  |:...:|::
Mosquito   106 VALVRIEGTFGGYEN--VAPIPLRTRTIFTSSSNPVYCTVSGWGLTNMNGDGLPEILRIVRIPLV 168

  Fly   201 NKELCQ---VIYKLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYT 262
            ....|:   ..:.:.:|.:|||.|:.  |||.|||||||:|:|:|.||:|||.......|||:||
Mosquito   169 PYTECRRKWNPFPITSSMICAGELRK--DACNGDSGGPLVCNGQLYGIVSWGSNQCGSSYPGIYT 231

  Fly   263 NVSHFLKWIRRANASLDYSEY 283
            ::...|.::         |||
Mosquito   232 SIPAVLSFL---------SEY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 80/249 (32%)
Tryp_SPc 38..273 CDD:238113 80/250 (32%)
AgaP_AGAP001247XP_001689376.2 Tryp_SPc 16..238 CDD:214473 79/247 (32%)
Tryp_SPc 17..242 CDD:238113 80/259 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.