DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP006488

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_001688886.1 Gene:AgaP_AGAP006488 / 5667298 VectorBaseID:AGAP006488 Length:260 Species:Anopheles gambiae


Alignment Length:263 Identity:66/263 - (25%)
Similarity:102/263 - (38%) Gaps:39/263 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ATASPFVILPKIVG--GYTVTI---------DQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRV 80
            |..:..|:|..|:|  ..|.|:         ..|.| ||..|   |:|       |.|.||:...
Mosquito     4 AVITSIVLLGAILGCQAQTETVVRNVGFGEYPSVVF-VSTPR---HQR-------CMGTVINANH 57

  Fly    81 VCSAAHCYAINTSVPLVYRDPELYV-VVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIA 144
            |.::..| .:......:|  |.|.| ||.|..::.......|..:.|.|..|:.:...|.:|::|
Mosquito    58 VLTSGTC-VMTDGAARIY--PALLVQVVGGDLSVPNPVVTQQTRVAQHIFVHEHFRPRTNDNNVA 119

  Fly   145 LLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQQAPVPILNKELCQV-- 207
            ::.|.......|.|:....:.::...:|..|.:    ..|....|..||...|.|.|:.||..  
Mosquito   120 IIRLAEPFHLPSNGIEEAHIRMRIVPQGHQCDV----VRTTLTGSPVLQAYNVQIRNRNLCDSCC 180

  Fly   208 --IYKLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKW 270
              |:: ..|.:|...:.......||||   :.|||.|..|.:..|. .|......:..|..|..|
Mosquito   181 LDIFR-EESNICTEPITISDSLLQGDS---MFCDGELTAIAATVVS-NDQTREFHFNQVRFFTHW 240

  Fly   271 IRR 273
            |::
Mosquito   241 IQQ 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 61/249 (24%)
Tryp_SPc 38..273 CDD:238113 63/250 (25%)
AgaP_AGAP006488XP_001688886.1 Tryp_SPc 32..222 CDD:304450 53/211 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.