DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CLIPC6

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_001687772.2 Gene:CLIPC6 / 5666762 VectorBaseID:AGAP000315 Length:361 Species:Anopheles gambiae


Alignment Length:268 Identity:73/268 - (27%)
Similarity:113/268 - (42%) Gaps:53/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAIN--TSVPLVYRD 100
            |:.|...:..:.||..::...:..|....:.:.||.::||...:.:||||...|  .:|.::..:
Mosquito   107 IIDGEEASEGEFPFMAALGYPTDDETQQNISYRCGASMISTDFLLTAAHCIPTNDRPTVAILGTN 171

  Fly   101 ---PELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAI 162
               |..:.|:.|..|               ...|.||..:...:||||:.|...|..| |.|..|
Mosquito   172 NLAPGNHGVLVGLKA---------------FFPHPDYRTNRNYHDIALVQLERRIENE-PDVNPI 220

  Fly   163 PL---AIKAPEEGTTCLIHGWGKVTMKE--KSASLQQAPVPILNKELCQVIY----------KLP 212
            .|   ....||: |.....|:|.:.:..  :|..|.:..:..:..:.|...:          |||
Mosquito   221 CLNDDLSDLPED-TVLTAEGYGIIDLDRNLRSNQLMKVNLTTVPWQKCNQTFADSNLLKNNRKLP 284

  Fly   213 ----ASQMCAGFLQG------GIDACQGDSGGPL--ICDG--RLAGIISWGVGCADPGYPGVYTN 263
                |:|.||...:.      | |.|||||||||  :.||  :|.|:.|:|.||.. ..|.|.|.
Mosquito   285 QGIVATQYCATGRENEEKKVVG-DTCQGDSGGPLQIMDDGKYKLVGVTSFGNGCGS-NTPSVSTR 347

  Fly   264 VSHFLKWI 271
            |:.::.||
Mosquito   348 VAAYIDWI 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 71/266 (27%)
Tryp_SPc 38..273 CDD:238113 73/268 (27%)
CLIPC6XP_001687772.2 CLIP 31..77 CDD:288855
Tryp_SPc 106..355 CDD:214473 71/266 (27%)
Tryp_SPc 107..358 CDD:238113 73/268 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.