DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and TMPRSS4

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_005271670.1 Gene:TMPRSS4 / 56649 HGNCID:11878 Length:494 Species:Homo sapiens


Alignment Length:279 Identity:93/279 - (33%)
Similarity:130/279 - (46%) Gaps:52/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRD 100
            |::||....::|..|:|||::        |...|||||:::....|.:||||:..:|       |
Human   203 PRVVGVEEASVDSWPWQVSIQ--------YDKQHVCGGSILDPHWVLTAAHCFRKHT-------D 252

  Fly   101 PELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGS-TLENDIALLFLNGFIPWESPG-VRAIP 163
            ...:.|.|||   |:...|....:.:.|:  .::|.. ..:|||||:.|.  .|....| ||.|.
Human   253 VFNWKVRAGS---DKLGSFPSLAVAKIII--IEFNPMYPKDNDIALMKLQ--FPLTFSGTVRPIC 310

  Fly   164 LAIKAPE--EGTTCLIHGWG--KVTMKEKSASLQQAPVPILNKELCQV--IY--KLPASQMCAGF 220
            |.....|  ..|...|.|||  |....:.|..|.||.|.:::...|..  .|  ::....||||.
Human   311 LPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQGEVTEKMMCAGI 375

  Fly   221 LQGGIDACQGDSGGPLICDG---RLAGIISWGVGCADPGYPGVYTNVSHFLKWIRRANASLDYSE 282
            .:||:|.|||||||||:...   .:.||:|||.||..|..|||||.||.:|.||           
Human   376 PEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWI----------- 429

  Fly   283 YRQIPPLNLASRRSVSSSC 301
                  .|:...|::..||
Human   430 ------YNVWKDRTIQRSC 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 86/246 (35%)
Tryp_SPc 38..273 CDD:238113 88/247 (36%)
TMPRSS4XP_005271670.1 LDLa 58..92 CDD:238060
SRCR_2 108..197 CDD:295335
Tryp_SPc 204..429 CDD:214473 86/246 (35%)
Tryp_SPc 205..432 CDD:238113 88/265 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.