DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Klk4

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_064312.1 Gene:Klk4 / 56640 MGIID:1861379 Length:255 Species:Mus musculus


Alignment Length:278 Identity:82/278 - (29%)
Similarity:131/278 - (47%) Gaps:49/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WM--CLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGL 67
            |.  ||::..|  |.:.|.:..            :|:.|...:....|:|.::....        
Mouse    11 WFLGCLILEVT--GASASSVSS------------RIIQGQDCSPHSQPWQAALFSED-------- 53

  Fly    68 GHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAG----SSAIDRTDRFTQEYLVQRI 128
            |..|.|.::..:.|.|||||.            .|.|:|..|    ..:.:...|..:.:|   .
Mouse    54 GFFCSGVLVHPQWVLSAAHCL------------QESYIVGLGLHNLKGSQEPGSRMLEAHL---S 103

  Fly   129 VGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQ 193
            :.|.::|..:..||:.|:.||..: .||..:|:||:|.:.|..|.|||:.|||::...:..:.||
Mouse   104 IQHPNFNDPSFANDLMLIKLNESV-IESNTIRSIPVATQCPTPGDTCLVSGWGQLKNGKLPSLLQ 167

  Fly   194 QAPVPILNKELCQVIYKLPA---SQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVG-CAD 254
            ...:.:.::|.|:::|. |.   |..|||..|...|:|.||||||::|:..|.|::|.|.| |..
Mouse   168 CVNLSVASEETCRLLYD-PVYHLSMFCAGGGQDQKDSCNGDSGGPIVCNRSLQGLVSMGQGKCGQ 231

  Fly   255 PGYPGVYTNVSHFLKWIR 272
            ||.|.||||:..|..||:
Mouse   232 PGIPSVYTNLCKFTNWIQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 74/241 (31%)
Tryp_SPc 38..273 CDD:238113 76/243 (31%)
Klk4NP_064312.1 Tryp_SPc 32..251 CDD:238113 76/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.