DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AZU1

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:272 Identity:79/272 - (29%)
Similarity:124/272 - (45%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCG 72
            |.::|..:|:..|.    .|.:||   |..||||......|.||..|::.:.   ||:     ||
Human     4 LTVLALLAGLLASS----RAGSSP---LLDIVGGRKARPRQFPFLASIQNQG---RHF-----CG 53

  Fly    73 GAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGS 137
            ||:|..|.|.:||.|:.        .::|.:..||.|:..:.|.:|.:::......:....|:..
Human    54 GALIHARFVMTAASCFQ--------SQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQ 110

  Fly   138 TLENDIALLFLNGFIPWESPGVRAIPLAIK--APEEGTTCLIHGWGKVTMKEKSASLQQAP---- 196
            ...||:.||.|:......| .|..:||.::  ..|.||.|.:.|||.   :.....|.:.|    
Human   111 QNLNDLMLLQLDREANLTS-SVTILPLPLQNATVEAGTRCQVAGWGS---QRSGGRLSRFPRFVN 171

  Fly   197 VPILNKELCQVIYKLPASQMCAGFL--QGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPG 259
            |.:..::.|:      .:.:|.|.|  :|||  |.||.|.||:|:|...|:.|:.:|....| |.
Human   172 VTVTPEDQCR------PNNVCTGVLTRRGGI--CNGDGGTPLVCEGLAHGVASFSLGPCGRG-PD 227

  Fly   260 VYTNVSHFLKWI 271
            .:|.|:.|..||
Human   228 FFTRVALFRDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 69/241 (29%)
Tryp_SPc 38..273 CDD:238113 71/242 (29%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 71/242 (29%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 12/31 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.