DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and KLK10

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:287 Identity:84/287 - (29%)
Similarity:126/287 - (43%) Gaps:54/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDHLWM--CLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHER 63
            |..||.  ..|:....:.:.....|.|.|..|.                  |:|||:        
Human    25 MAQLWAAEAALLPQNDTRLDPEAYGSPCARGSQ------------------PWQVSL-------- 63

  Fly    64 HYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRI 128
            ..||...|.|.::.|..|.:||||    .:.||..|..:.::::.....:.||.|        .:
Human    64 FNGLSFHCAGVLVDQSWVLTAAHC----GNKPLWARVGDDHLLLLQGEQLRRTTR--------SV 116

  Fly   129 VGHKDYNGS-------TLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMK 186
            |..|.:.||       |.|:|:.||.|...:.. .|.|||:.|..:..:.|..|.:.|||....:
Human   117 VHPKYHQGSGPILPRRTDEHDLMLLKLARPVVL-GPRVRALQLPYRCAQPGDQCQVAGWGTTAAR 180

  Fly   187 --EKSASLQQAPVPILNKELCQVIYK--LPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIIS 247
              :.:..|..:.:.||:.:.|:|.|.  :..:.:||| |..|.|.||.||||||:||..|.||:|
Human   181 RVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAG-LDRGQDPCQSDSGGPLVCDETLQGILS 244

  Fly   248 WGV-GCADPGYPGVYTNVSHFLKWIRR 273
            ||| .|....:|.|||.:..::.||.:
Human   245 WGVYPCGSAQHPAVYTQICKYMSWINK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 74/245 (30%)
Tryp_SPc 38..273 CDD:238113 76/246 (31%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 80/263 (30%)
Tryp_SPc 49..269 CDD:214473 78/259 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.