DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and KLK6

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001012982.1 Gene:KLK6 / 5653 HGNCID:6367 Length:244 Species:Homo sapiens


Alignment Length:246 Identity:77/246 - (31%)
Similarity:121/246 - (49%) Gaps:36/246 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGH-VCGGAVISQRVVCSAAHCYAINTSVPLVYRD 100
            |:|.|........|:|.::         |..|| :|||.:|....|.:||||           :.
Human    21 KLVHGGPCDKTSHPYQAAL---------YTSGHLLCGGVLIHPLWVLTAAHC-----------KK 65

  Fly   101 PELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPG-----VR 160
            |.|.|.: |...:.:.:...::..|.|.|.|.||:.::.:.||.||.|      ..|.     ::
Human    66 PNLQVFL-GKHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRL------ARPAKLSELIQ 123

  Fly   161 AIPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQQAPVPILNKELCQVIY--KLPASQMCAGFLQG 223
            .:||........|:|.|.||||....:...::|.|.:.::::|.|:..|  ::..:.:|||..:.
Human   124 PLPLERDCSANTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKY 188

  Fly   224 GIDACQGDSGGPLICDGRLAGIISWG-VGCADPGYPGVYTNVSHFLKWIRR 273
            |.|:|||||||||:|...|.|::||| :.|.....|||||||..:..||::
Human   189 GKDSCQGDSGGPLVCGDHLRGLVSWGNIPCGSKEKPGVYTNVCRYTNWIQK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 75/242 (31%)
Tryp_SPc 38..273 CDD:238113 76/243 (31%)
KLK6NP_001012982.1 Tryp_SPc 23..237 CDD:214473 74/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5520
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.