DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:214 Identity:70/214 - (32%)
Similarity:102/214 - (47%) Gaps:52/214 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 VVVAGS---SAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFI-----------PWE 155
            :||||.   .|.:.|:::::..:   ::.|..||.||...||.|:.|:..|           |.:
Zfish     5 MVVAGDYTLGANEGTEQYSKPLM---LIPHPLYNRSTNNADIMLIKLSAPIELNRYVSLAPLPKQ 66

  Fly   156 SPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEK--SASLQQAPVPILNKELC----QVIYKLPAS 214
            :.|:.|          |..|.:.|||..:....  ..:|:...:||::...|    .....:.|:
Zfish    67 NTGLLA----------GRMCRVSGWGSTSHSGGLIPLTLRTVRLPIVSTFKCNSSSSFSGNITAN 121

  Fly   215 QMCAGFLQGGIDA---------------CQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNV 264
            .:|||...||.||               |||||||||:||||:.|::|||.||.||.:|||||.|
Zfish   122 MICAGSSTGGKDACKNSTQYLCHLIVYLCQGDSGGPLVCDGRVYGLVSWGNGCGDPRFPGVYTAV 186

  Fly   265 SHFLKWIRRANASLDYSEY 283
            |.|.:||.:.    .||.|
Zfish   187 SRFRRWIDQT----IYSTY 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 65/200 (33%)
Tryp_SPc 38..273 CDD:238113 67/202 (33%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 67/203 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.