DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and si:dkey-33m11.8

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_693464.3 Gene:si:dkey-33m11.8 / 565078 ZFINID:ZDB-GENE-141215-49 Length:251 Species:Danio rerio


Alignment Length:273 Identity:92/273 - (33%)
Similarity:135/273 - (49%) Gaps:49/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCG 72
            ||||:...|..|.                :|:||..|....:.:|.||:        |...|.||
Zfish    10 LLIVSMLQGSKQQ----------------RIIGGQEVQPYSIKYQASVQ--------YNNYHYCG 50

  Fly    73 GAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGS 137
            |.:|..:.|.|||||          :|...|..||.....:.:.:.|.:.:.|.:.:.|..||..
Zfish    51 GTLIHPQWVVSAAHC----------WRPSYLIKVVLSEHDLSKIEGFERVFNVSKALVHYMYNYR 105

  Fly   138 TLENDIALLFLNGFIPWE-----SPGVRAIPLAIKAPEEGTTCLIHGWG--KVTMKEKSASLQQA 195
            |.::||.||.|..  |.|     .|.|  :|:::.|.:.||.|::.|||  :|.....|..|:..
Zfish   106 TFDSDIMLLKLEK--PAELSATIQPAV--LPVSVPALQGGTVCIVSGWGVTQVYSYYLSPVLRAV 166

  Fly   196 PVPILNKELCQ--VIYKLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYP 258
            .|.|:.:  ||  ..|::..:.:|||...||.|:|||||||||||:|...||:|||:.||:..:|
Zfish   167 DVQIIPQ--CQYYYYYRITDNMVCAGSPLGGKDSCQGDSGGPLICNGYFEGIVSWGISCANAYFP 229

  Fly   259 GVYTNVSHFLKWI 271
            ||||.|.:::.|:
Zfish   230 GVYTKVRNYIPWM 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 85/242 (35%)
Tryp_SPc 38..273 CDD:238113 86/243 (35%)
si:dkey-33m11.8XP_693464.3 Tryp_SPc 23..241 CDD:214473 85/241 (35%)
Tryp_SPc 24..241 CDD:238113 85/240 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.