DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and PRSS2

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:280 Identity:106/280 - (37%)
Similarity:142/280 - (50%) Gaps:39/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHV 70
            |.||::.|...         .|.|:||....||||||....:.||:|||:....         |.
Human     1 MNLLLILTFVA---------AAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGY---------HF 47

  Fly    71 CGGAVISQRVVCSAAHCY--AINTSVPLVYRDPELY--VVVAGSSAIDRTDRFTQEYLVQRIVGH 131
            |||::||::.|.||.|||  |||:.  |..|..|.:  .|..|...|:..:...|.....:|:.|
Human    48 CGGSLISEQWVVSAGHCYKSAINSK--LSGRGCEYHRIQVRLGEHNIEVLEGNEQFINAAKIIRH 110

  Fly   132 KDYNGSTLENDIALLFLNGFIPWESPG-----VRAIPLAIKAPEEGTTCLIHGWGKVTMK--EKS 189
            ..||..||:|||.|:.|:      ||.     |.||.|....|..||..||.|||.....  :..
Human   111 PKYNSRTLDNDILLIKLS------SPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYP 169

  Fly   190 ASLQQAPVPILNKELCQVIY--KLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGC 252
            ..||....|:|::..|:..|  |:..:..|.|||:||.|:||||||||::.:|.|.||:|||.||
Human   170 DELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGC 234

  Fly   253 ADPGYPGVYTNVSHFLKWIR 272
            |....|||||.|.:::.||:
Human   235 AQKNRPGVYTKVYNYVDWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 96/246 (39%)
Tryp_SPc 38..273 CDD:238113 97/248 (39%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 96/246 (39%)
Tryp_SPc 24..256 CDD:238113 97/248 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.