DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and PRSS1

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:290 Identity:101/290 - (34%)
Similarity:145/290 - (50%) Gaps:40/290 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCLLIVATHSGITQSQIGQPT------------ATASPFVILPKIVGGYTVTIDQVPFQVSVR 56
            ||  :|:.......|.||....|            |.|:||....||||||....:.||:|||:.
Human   205 LW--ILVRYKDESSTTSQAHSTTMNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLN 267

  Fly    57 RRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQ 121
            ...         |.|||::|:::.|.||.|||.....|.|...:.|:         ::..::|..
Human   268 SGY---------HFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEV---------LEGNEQFIN 314

  Fly   122 EYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMK 186
               ..:|:.|..|:..||.|||.|:.|:......: .|..|.|....|..||.|||.|||.....
Human   315 ---AAKIIRHPQYDRKTLNNDIMLIKLSSRAVINA-RVSTISLPTAPPATGTKCLISGWGNTASS 375

  Fly   187 --EKSASLQQAPVPILNKELCQVIY--KLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIIS 247
              :....||....|:|::..|:..|  |:.::..|.|||:||.|:||||||||::|:|:|.|::|
Human   376 GADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVS 440

  Fly   248 WGVGCADPGYPGVYTNVSHFLKWIRRANAS 277
            ||.|||....|||||.|.:::|||:...|:
Human   441 WGDGCAQKNKPGVYTKVYNYVKWIKNTIAA 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 87/237 (37%)
Tryp_SPc 38..273 CDD:238113 88/238 (37%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 87/237 (37%)
Tryp_SPc 249..467 CDD:238113 88/239 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.