DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and PROC

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_024308770.1 Gene:PROC / 5624 HGNCID:9451 Length:576 Species:Homo sapiens


Alignment Length:261 Identity:72/261 - (27%)
Similarity:117/261 - (44%) Gaps:50/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PKIVGGYTVTIDQVPFQVSV--RRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVY 98
            |:::.|........|:||.:  .::.:         .||..:|....|.:||||  ::.|..|:.
Human   325 PRLIDGKMTRRGDSPWQVVLLDSKKKL---------ACGAVLIHPSWVLTAAHC--MDESKKLLV 378

  Fly    99 RDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRA-- 161
            |        .|...:.|.:::..:..::.:..|.:|:.||.:||||||.|      ..|...:  
Human   379 R--------LGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDIALLHL------AQPATLSQT 429

  Fly   162 -IPLAI--------KAPEEGTTCLIHGWGKVTMKEKSAS------LQQAPVPILNKELCQVIYKL 211
             :|:.:        :..:.|...|:.|||..:.:||.|.      |....:|::....|..:...
Human   430 IVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVLNFIKIPVVPHNECSEVMSN 494

  Fly   212 PASQ--MCAGFLQGGIDACQGDSGGPLICDGR----LAGIISWGVGCADPGYPGVYTNVSHFLKW 270
            ..|:  :|||.|....|||:||||||::....    |.|::|||.||......||||.||.:|.|
Human   495 MVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLVSWGEGCGLLHNYGVYTKVSRYLDW 559

  Fly   271 I 271
            |
Human   560 I 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 69/258 (27%)
Tryp_SPc 38..273 CDD:238113 71/259 (27%)
PROCXP_024308770.1 GLA 117..168 CDD:214503
EGF_CA 182..213 CDD:238011
FXa_inhibition 255..290 CDD:317114
Tryp_SPc 328..563 CDD:238113 71/258 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.