DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and zgc:112285

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001020685.1 Gene:zgc:112285 / 561476 ZFINID:ZDB-GENE-050913-132 Length:316 Species:Danio rerio


Alignment Length:260 Identity:81/260 - (31%)
Similarity:128/260 - (49%) Gaps:37/260 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :||.|........|:|||::.|....:||  .|||||.:|.:..|.:||||:....:     .|.
Zfish    58 RIVSGNEARPHSWPWQVSLQVRPRGSKHY--VHVCGGTLIHKNWVLTAAHCFQKGKA-----EDA 115

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYN---GSTLENDIALLFL------NGFIPWESP 157
            ..:.:|.|...:.|::...:.:.|:||..|:.:.   .|.|:.||||:..      :.||.:...
Zfish   116 SSWRIVLGKHQLKRSETAERFFPVKRIYRHEHFRYPAHSELDYDIALVKAATDIQPSNFIRYACL 180

  Fly   158 GVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSAS----LQQAPVPILNKELCQVIY----KLPAS 214
            ..:.|.|     ..|..|.:.|||.....:::.|    |.||.:||::.:.|:...    ::..|
Zfish   181 PRKQINL-----NPGHYCWVTGWGDTRGGKENVSLAEALNQARLPIIDYKTCRQKKFWGDRVRDS 240

  Fly   215 QMCAGF--LQGGIDACQGDSGGPLICD-GR----LAGIISWG-VGCADPGYPGVYTNVSHFLKWI 271
            .:||||  .:|...||||||||||:|. ||    :.||:|:| :||.....|.|:|..:.::.||
Zfish   241 MICAGFRDTEGTPAACQGDSGGPLLCQVGRDRWEVHGIVSFGPIGCTVENKPSVFTRTAAYIPWI 305

  Fly   272  271
            Zfish   306  305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 79/258 (31%)
Tryp_SPc 38..273 CDD:238113 81/259 (31%)
zgc:112285NP_001020685.1 Tryp_SPc 58..305 CDD:214473 79/258 (31%)
Tryp_SPc 59..308 CDD:238113 81/259 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.