DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and zmp:0000001088

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_688573.1 Gene:zmp:0000001088 / 560086 ZFINID:ZDB-GENE-140106-48 Length:263 Species:Danio rerio


Alignment Length:285 Identity:89/285 - (31%)
Similarity:135/285 - (47%) Gaps:58/285 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG 68
            |.:|:|:             :..|.:...||..:|||||......:.:.||::..:..       
Zfish     6 LLLCVLL-------------EILAVSCQDVIQARIVGGYVPAPYSIKYIVSIQSATGQ------- 50

  Fly    69 HVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKD 133
            |.|||.:|::..|.:||||.....::.          :|||..::...:...|......::.|..
Zfish    51 HFCGGTLINKYWVLTAAHCNIGEANMR----------IVAGDYSVGLYEGMEQFRRPHMLIPHPQ 105

  Fly   134 YNGSTLENDIALL------FLNGFIPWESPGVRAIPLAIKAPEE------GTTCLIHGWGKVTMK 186
            |:.||...||.|:      :||.:       |..:||    |.:      |..|.:.|||..|..
Zfish   106 YDRSTNNADIMLIKLQSPVYLNSY-------VSLVPL----PRQDAMVAVGRLCSVSGWGFTTST 159

  Fly   187 EK-SASLQQAPVPILNKELC----QVIYKLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGII 246
            .. |:.|:...:||::..:|    .....:..:.:|||:..||.|||:|||||||:|:||:.||:
Zfish   160 GGISSILRTVKLPIVSTAVCNGTDSFNGNITENMICAGYSTGGKDACKGDSGGPLVCEGRVYGIV 224

  Fly   247 SWGVGCADPGYPGVYTNVSHFLKWI 271
            |||.||||..||||||.||.|.:||
Zfish   225 SWGNGCADAQYPGVYTAVSQFRQWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 81/250 (32%)
Tryp_SPc 38..273 CDD:238113 83/251 (33%)
zmp:0000001088XP_688573.1 Tryp_SPc 26..249 CDD:214473 81/250 (32%)
Tryp_SPc 27..252 CDD:238113 83/251 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.