DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and LOC560023

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_021325702.1 Gene:LOC560023 / 560023 -ID:- Length:271 Species:Danio rerio


Alignment Length:281 Identity:93/281 - (33%)
Similarity:138/281 - (49%) Gaps:56/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCL-LIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGL 67
            ||:.| |.|......:|                 :|:||..|....:.:|||::   :..:|:  
Zfish    26 LWVFLVLAVMVRDAFSQ-----------------RIIGGQEVVPYSIKYQVSLQ---VDRKHF-- 68

  Fly    68 GHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHK 132
               |||.:|..:.|.:||||:...:.:.:|..:..|.|          .:.|.|...|.::..|.
Zfish    69 ---CGGTLIQPQWVLTAAHCWRPASVIQVVLSEHNLAV----------EEGFEQVCTVAKVFSHV 120

  Fly   133 DYNGSTLENDIALLFL------NGFIPWESPGVRAIPLAIKAPE--EGTTCLIHGWGKVTMKE-- 187
            .||..|..|||.::.|      |.::   .|.:  :|.| ..||  .|::|.:.|||...:..  
Zfish   121 AYNPKTFNNDIMIIKLTAPAQINAYV---QPAL--LPTA-DTPELAGGSSCTVSGWGVTRLYNFY 179

  Fly   188 KSASLQQAPVPILNKELCQV--IYKLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGV 250
            .|..|:...|.|.:.  ||:  .|::..:.:|||...||.|:|||||||||||||.|.||:|||:
Zfish   180 LSPILRAVDVEIFSS--CQLYYYYRVNDNMICAGSRFGGKDSCQGDSGGPLICDGYLEGIVSWGI 242

  Fly   251 GCADPGYPGVYTNVSHFLKWI 271
            |||.|.||||||.|.::.:||
Zfish   243 GCALPYYPGVYTKVRNYNRWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 85/245 (35%)
Tryp_SPc 38..273 CDD:238113 87/246 (35%)
LOC560023XP_021325702.1 Tryp_SPc 43..263 CDD:214473 85/245 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.