DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and cfi

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_017209949.1 Gene:cfi / 557557 ZFINID:ZDB-GENE-110922-7 Length:714 Species:Danio rerio


Alignment Length:252 Identity:87/252 - (34%)
Similarity:129/252 - (51%) Gaps:37/252 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVR-RRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRD 100
            ::|||......|:.:||::: ..|||         |||..:....|.:||||         |...
Zfish   471 RLVGGEESLPTQIQWQVAIQDEGSIH---------CGGVYLGGCWVLTAAHC---------VRPK 517

  Fly   101 PELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIAL-----LFLNGFIPWESPGVR 160
            |:.:.|.......:|....|....|::|:.|::|:..|..|||||     |.|:.....::|.:|
Zfish   518 PKSFRVKFSLWRKNRKQSTTDSIPVKKIIIHENYDAQTYVNDIALVQLEELNLSDKCMLDNPAIR 582

  Fly   161 A--IPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQQAPVPILNKELCQVIYK---LPASQMCAGF 220
            |  :|.:.:..:...||.|.|||:......::.|:.|.|.|:..  ||..||   ||..: |||.
Zfish   583 AVCVPWSTQQFQPNDTCTISGWGRDKAGMSASILKWANVTIIGD--CQNFYKHRFLPGME-CAGD 644

  Fly   221 LQGGIDACQGDSGGPLICD-----GRLAGIISWGVGCADPGYPGVYTNVSHFLKWIR 272
            |:|.:|:|||||||||:|.     ..:.||:|||..|.:|.:|||||.|:|:..|||
Zfish   645 LEGKVDSCQGDSGGPLVCKDASGLSYVWGIVSWGDKCGEPNHPGVYTKVAHYFDWIR 701

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 84/249 (34%)
Tryp_SPc 38..273 CDD:238113 87/251 (35%)
cfiXP_017209949.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.