DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and KLK15

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:285 Identity:88/285 - (30%)
Similarity:126/285 - (44%) Gaps:51/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG 68
            :|: ||.::.....|.:|.|.            |::.|........|:||::..|....      
Human     1 MWL-LLTLSFLLASTAAQDGD------------KLLEGDECAPHSQPWQVALYERGRFN------ 46

  Fly    69 HVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKD 133
              ||.::||...|.|||||.:....|.|            |...:.:.|...|.....|::.|..
Human    47 --CGASLISPHWVLSAAHCQSRFMRVRL------------GEHNLRKRDGPEQLRTTSRVIPHPR 97

  Fly   134 YNGSTLENDIALLFLNGFIPWE-SPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSA------- 190
            |...:..|||.||.|  ..|.. :|.||...|..:.|..|..|::.|||.|:..|...       
Human    98 YEARSHRNDIMLLRL--VQPARLNPQVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQ 160

  Fly   191 -----SLQQAPVPILNKELCQVIY--KLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISW 248
                 :|..|.:.|::...|...|  :|..:.:|||....|.::|:|||||||:|.|.|.||:||
Human   161 VSLPDTLHCANISIISDTSCDKSYPGRLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSW 225

  Fly   249 G-VGCADPGYPGVYTNVSHFLKWIR 272
            | |.|.:...|||||.|.|:|:|||
Human   226 GDVPCDNTTKPGVYTKVCHYLEWIR 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 79/249 (32%)
Tryp_SPc 38..273 CDD:238113 81/251 (32%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 78/245 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.