DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and zgc:112038

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:282 Identity:90/282 - (31%)
Similarity:139/282 - (49%) Gaps:36/282 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELY 104
            ||........|:|.|:.|.|..:      |:|||::|::..|.|||||:.|..:..:.......:
Zfish    37 GGDDAVAGSWPWQASIHRISPED------HICGGSLINKDWVLSAAHCFMITATANIKIFLGRQF 95

  Fly   105 VVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAP 169
            ...:..:.|.||        :.:||.|.||:.:|..||||||.|:..:.: :..:|  |:.:.:.
Zfish    96 QTGSNPNEISRT--------LTQIVIHPDYSTTTQNNDIALLRLSSSVTF-TDYIR--PVCLASA 149

  Fly   170 EE----GTTCLIHGWGKVTMKEKSAS--LQQAPVPILNKELCQVIYK--LPASQMCAGFLQGGID 226
            :.    ||...|.||.|....:...:  ||:..:|:::...|...||  :..:.:|||..:||.|
Zfish   150 DSVFAGGTKSWITGWDKHRSSDIQVTNVLQEVQLPVVSNTECNADYKGIITDNMICAGINEGGKD 214

  Fly   227 ACQGDSGGPLICDGR----LAGIISWGVGCADPGYPGVYTNVSHFLKWIR---RAN----ASLDY 280
            |||||||||::....    .:||:|:|..|..|.|||:||.||.:..||.   |.|    .|...
Zfish   215 ACQGDSGGPMVSQNGSRWIQSGIVSFGRECGLPRYPGIYTRVSQYQSWITSELRTNLPGFVSFTS 279

  Fly   281 SEYRQIPPLNLASRRSVSSSCL 302
            :|.|...|..|:...|::||.|
Zfish   280 TETRSSSPSLLSFYFSLTSSLL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 77/242 (32%)
Tryp_SPc 38..273 CDD:238113 79/247 (32%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 77/242 (32%)
Tryp_SPc 37..263 CDD:238113 77/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.