DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and prss1

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001015792.1 Gene:prss1 / 548509 XenbaseID:XB-GENE-5776262 Length:244 Species:Xenopus tropicalis


Alignment Length:248 Identity:94/248 - (37%)
Similarity:132/248 - (53%) Gaps:32/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            |||||:|.|.:.||:|||:....         |.|||::|:.:.|.||||||.....|.|     
 Frog    21 KIVGGFTCTKNAVPYQVSLNAGY---------HFCGGSLINSQWVVSAAHCYKSRIQVRL----- 71

  Fly   102 ELYVVVAGSSAI---DRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIP 163
                   |...|   :.|::|.:.   |:::.|..||...|:|||.|:.|:......| .::::|
 Frog    72 -------GEHNIAVNEGTEQFIES---QKVIKHPSYNSRNLDNDIMLIKLSTTARLSS-NIQSVP 125

  Fly   164 LAIKAPEEGTTCLIHGWGKVTMKEKSAS--LQQAPVPILNKELCQVIY--KLPASQMCAGFLQGG 224
            |.......||.|||.|||.......:..  ||....|||....|...|  ::..:..|||||.||
 Frog   126 LPSACASAGTNCLISGWGNTLSSGTNYPDLLQCLNAPILTASECSNSYPGEITNNMFCAGFLAGG 190

  Fly   225 IDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWIRRANAS 277
            .|:||||||||::|:|:|.|::|||.|||...||||||.|.:::.||:...|:
 Frog   191 KDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNYPGVYTKVCNYVSWIQNTIAA 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 91/240 (38%)
Tryp_SPc 38..273 CDD:238113 92/241 (38%)
prss1NP_001015792.1 Tryp_SPc 22..240 CDD:238113 92/242 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.