DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Cfd

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001071110.1 Gene:Cfd / 54249 RGDID:2498 Length:263 Species:Rattus norvegicus


Alignment Length:256 Identity:78/256 - (30%)
Similarity:124/256 - (48%) Gaps:33/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :|:||........|:..||:....        |||||.::.::.|.|||||      :..|.:| 
  Rat    25 RILGGQEAMAHARPYMASVQVNGT--------HVCGGTLVDEQWVLSAAHC------MDGVTKD- 74

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFL--NGFIPWESPGVRAIPL 164
            |:..|:.|:.::...:.:...|.||.:|.|......::|:|:.|..|  |..:   .|.||.:||
  Rat    75 EVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASL---GPHVRPLPL 136

  Fly   165 AIKAPE--EGTTCLIHGWGKVTMKEKSAS-LQQAPVPILNKELCQV-IY---KLPASQMCAGFLQ 222
            ..:..|  .||.|.:.|||.||...:... |||..|.|:::..|.: .|   .:..:.|||.  .
  Rat   137 QREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAE--S 199

  Fly   223 GGIDACQGDSGGPLICDGRLAGIISWGVG-CADPGYPGVYTNVSHFLKWIRR---ANASLD 279
            ...|.|:|||||||:|...:..:::||.. |.:...|||:|.|:.::.||..   .|.|::
  Rat   200 NRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 74/243 (30%)
Tryp_SPc 38..273 CDD:238113 76/244 (31%)
CfdNP_001071110.1 Tryp_SPc 26..252 CDD:238113 76/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.