DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Elane

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:265 Identity:86/265 - (32%)
Similarity:122/265 - (46%) Gaps:57/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAH 86
            :|.| |.||      :||||........||..|::||.        ||.||..:|::..|.||||
Mouse    20 LGGP-ALAS------EIVGGRPARPHAWPFMASLQRRG--------GHFCGATLIARNFVMSAAH 69

  Fly    87 CYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGF 151
            |  :|   .|.:|..:   ||.|:..:.|.:|..|.:.||||. ...::.|.|.|||.::.||| 
Mouse    70 C--VN---GLNFRSVQ---VVLGAHDLRRQERTRQTFSVQRIF-ENGFDPSQLLNDIVIIQLNG- 124

  Fly   152 IPWESPGVRAIPLAIKAPEEG------TTCLIHGWGKVTMKEKSAS-LQQAPVPILNK------E 203
                |..:.|.....:.|.:|      |.||..|||::.....|.| ||:..|.::..      .
Mouse   125 ----SATINANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVVTNMCRRRVN 185

  Fly   204 LCQVIYKLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISW--GVGCADPGYPGVYTNVSH 266
            :|.::.:          .|.||  |.|||||||:|:..:.||.|:  | ||....||..:..|:.
Mouse   186 VCTLVPR----------RQAGI--CFGDSGGPLVCNNLVQGIDSFIRG-GCGSGLYPDAFAPVAE 237

  Fly   267 FLKWI 271
            |..||
Mouse   238 FADWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 79/248 (32%)
Tryp_SPc 38..273 CDD:238113 81/249 (33%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 79/248 (32%)
Tryp_SPc 29..245 CDD:238113 81/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.