DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and prss1.2

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001011251.1 Gene:prss1.2 / 496697 XenbaseID:XB-GENE-6083469 Length:249 Species:Xenopus tropicalis


Alignment Length:280 Identity:92/280 - (32%)
Similarity:134/280 - (47%) Gaps:51/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG 68
            ||:.|.:.              .|.|:| :...||||||..|....|:||...:.|        .
 Frog     4 LWILLFLA--------------VAAAAP-LDDDKIVGGYECTPHSQPWQVYFTQNS--------Q 45

  Fly    69 HVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKD 133
            ..|||::::.|.:.|||||          ||.|:..|...|...:.:.:...|...|:....|..
 Frog    46 VFCGGSLVTPRWIISAAHC----------YRPPKTLVAHLGDHDLTKEEGTEQHIQVEAAYKHSS 100

  Fly   134 YNGSTLENDIALLFL------NGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVT---MKEKS 189
            |.....::||.|:.|      |.:       |:.||:|...|.|||.||:.|:|.:.   :.|..
 Frog   101 YKDEAYDHDIMLVKLAKPAQYNQY-------VQPIPVARSCPREGTECLVSGYGNLRSDHIGEFP 158

  Fly   190 ASLQQAPVPILNKELCQVIYK--LPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGC 252
            ..||...||:|:...|:...:  ...:..|||||:||.|:||.||||||:|:|.|.|::|||.||
 Frog   159 DRLQCVDVPVLSDSSCKASCRGLFTENMFCAGFLEGGKDSCQVDSGGPLVCNGELYGVVSWGWGC 223

  Fly   253 ADPGYPGVYTNVSHFLKWIR 272
            |....||||..|.::|:|::
 Frog   224 AQRNAPGVYAKVCNYLRWVQ 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 85/244 (35%)
Tryp_SPc 38..273 CDD:238113 85/246 (35%)
prss1.2NP_001011251.1 Tryp_SPc 23..245 CDD:238113 85/246 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.