DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and tmprss2

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001008623.1 Gene:tmprss2 / 494080 ZFINID:ZDB-GENE-041212-48 Length:486 Species:Danio rerio


Alignment Length:272 Identity:98/272 - (36%)
Similarity:142/272 - (52%) Gaps:60/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQV-PFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRD 100
            :||||.|||...| |:|||:        ||...|:|||::|:...:.:||||..       .:.:
Zfish   251 RIVGGTTVTSKGVWPWQVSL--------HYSGRHLCGGSIITPYWILTAAHCVH-------QFSN 300

  Fly   101 PELYVVVAGSSAIDRTDRFTQEYL-------VQRIVGHKDYNGSTLENDIALLFLNGFIPWESPG 158
            |..:.|.||        ..||..:       |.|||.| |:|.:|.||||||:.||..:. .|..
Zfish   301 PGGWTVYAG--------YLTQSEMASASGNSVNRIVIH-DFNPNTNENDIALMRLNTALT-ISTN 355

  Fly   159 VRAIPLAIKAPEEGTT------CLIHGWGKV-TMKEKSASLQQAPVPILNKELC--QVIYK--LP 212
            :|.:.|    |.:|.:      |.:.|||.: :....||:||:|.:.:::..:|  :.:|.  :.
Zfish   356 IRPVCL----PNKGMSFTAQQDCYVTGWGALFSGGSSSATLQEAKIQLIDSTICNSRPVYNGLIT 416

  Fly   213 ASQMCAGFLQGGIDACQGDSGGPLICDGR----LAGIISWGVGCADPGYPGVYTNVSHFLKWIRR 273
            .:.:|||.|.||:|:|||||||||:.:.|    |.|..|||.|||....||||.||::||.||  
Zfish   417 DTMICAGKLAGGVDSCQGDSGGPLVTNVRSLWWLLGDTSWGDGCAVRNKPGVYGNVTYFLDWI-- 479

  Fly   274 ANASLDYSEYRQ 285
                  |.:.|:
Zfish   480 ------YQQMRK 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 94/256 (37%)
Tryp_SPc 38..273 CDD:238113 96/257 (37%)
tmprss2NP_001008623.1 LDLa 132..168 CDD:238060
SRCR_2 173..248 CDD:295335
Tryp_SPc 251..479 CDD:214473 94/256 (37%)
Tryp_SPc 252..482 CDD:238113 97/266 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.