DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP012504

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_001231011.2 Gene:AgaP_AGAP012504 / 4578496 VectorBaseID:AGAP012504 Length:839 Species:Anopheles gambiae


Alignment Length:228 Identity:67/228 - (29%)
Similarity:97/228 - (42%) Gaps:43/228 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 VCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAI--DRTDRFTQEYLVQRIVGHK 132
            :|||::|.:..:.:||||.|.:.:||     |:  |...|...|  |..|.|.|:..:..|:.|.
Mosquito    48 LCGGSLIWENFILTAAHCAADDDNVP-----PD--VARMGDINIYSDEDDEFAQQLKIVEIIRHP 105

  Fly   133 DYNGSTLENDIALLFLNGFIPWE---SPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSA---- 190
            .:..::...||||:.|...:...   :|....:...|:.||    .|..|||:....:.:.    
Mosquito   106 KHKYNSNYYDIALMKLERNVTLHDTVAPSCLWLDDEIRFPE----LLAAGWGRTGFDQNTTKTLL 166

  Fly   191 SLQQAPVPILNKELCQVIYK---------LPASQMCAGFLQGGIDACQGDSGGPLICD------- 239
            .:|.||:   ..:.|...|:         |...|.|||  ...:|.|.|||||||...       
Mosquito   167 KVQLAPI---TNDKCSTHYQRGVRKLENGLMDHQFCAG--DEKMDTCPGDSGGPLHVKLFKEWKL 226

  Fly   240 -GRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
             ..|.|:.|:|..|. ...||||..||.|..||
Mosquito   227 IPFLVGVTSFGKACG-LAAPGVYVKVSKFGDWI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 65/226 (29%)
Tryp_SPc 38..273 CDD:238113 67/228 (29%)
AgaP_AGAP012504XP_001231011.2 Tryp_SPc 22..261 CDD:238113 67/228 (29%)
Tryp_SPc 22..258 CDD:214473 65/226 (29%)
Trypsin 327..528 CDD:278516
Tryp_SPc 333..>433 CDD:304450
Tryp_SPc 611..836 CDD:304450
Tryp_SPc 611..832 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.