DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP010240

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_001238153.2 Gene:AgaP_AGAP010240 / 4578338 VectorBaseID:AGAP010240 Length:275 Species:Anopheles gambiae


Alignment Length:307 Identity:86/307 - (28%)
Similarity:128/307 - (41%) Gaps:77/307 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MCLLIVATHSGITQSQIGQPTATA---SPFVILP--------KIVGGYTVTIDQVPFQVSVRRRS 59
            |.|.||...:.:...|:..|...|   |...|:|        :||.|:..::.|.|:||.:    
Mosquito     1 MKLFIVVVLACLAAVQVRLPPQNAREISYQSIVPFREATRSSRIVNGFPASLGQFPYQVFL---- 61

  Fly    60 IHERHYGLGHV-CGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAG-----SSAIDRTDR 118
                 .|.|.: |||::||...|.:|||| .:..|         .:.|.||     |....||..
Mosquito    62 -----IGDGSLACGGSLISAEWVLTAAHC-QVGIS---------QFTVRAGSIQNNSGGTVRTSN 111

  Fly   119 FTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTT-------CL 176
            .        |:.|.:||.|.|.|||.|:.||..:|. ...::.:.|    ||...:       ..
Mosquito   112 L--------IIIHPNYNPSNLNNDIGLIRLNEPMPL-GGNIQVVAL----PEANLSETFLNREAT 163

  Fly   177 IHGWGKVTMKEK--SASLQQAPVPILNKELCQVIY---KLPASQMCAGFLQGGIDA-----CQGD 231
            :.|:|:.:....  |.:|....:.|::...|...|   .:..|.:||    .|.||     |.||
Mosquito   164 VSGFGRTSDASGAISPNLNFVHLNIISNIQCMGTYGSATIIDSTVCA----VGRDAPNQGTCNGD 224

  Fly   232 SGGPLIC--DGRLA--GIISW--GVGCADPGYPGVYTNVSHFLKWIR 272
            |||||..  :|:..  |::|:  ..|| :.|:|..|...:||..|||
Mosquito   225 SGGPLTVTENGQSVQIGVVSFVAAAGC-EVGFPSGYVRTTHFRNWIR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 73/262 (28%)
Tryp_SPc 38..273 CDD:238113 76/264 (29%)
AgaP_AGAP010240XP_001238153.2 Tryp_SPc 43..269 CDD:214473 73/262 (28%)
Tryp_SPc 44..272 CDD:238113 76/264 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.