DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP010798

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_001231167.2 Gene:AgaP_AGAP010798 / 4577817 VectorBaseID:AGAP010798 Length:276 Species:Anopheles gambiae


Alignment Length:281 Identity:87/281 - (30%)
Similarity:140/281 - (49%) Gaps:44/281 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVC 71
            |||:.::.|.:|.|.......:|...:.. :||.|...||...|:.||::|.:...:.    |:|
Mosquito    20 CLLLYSSRSYLTLSLAVMSEVSAKQKMSF-RIVNGTEATIVSYPYVVSIQRWTPRVKQ----HIC 79

  Fly    72 GGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNG 136
            ||.:||:..:.:|||| |...|       |...:|...||..:|..:.   :.|::::.|:.::.
Mosquito    80 GGTLISESWILTAAHC-ADKIS-------PTTVMVRVNSSFFNRGGKL---HRVEKVIKHERFSY 133

  Fly   137 STLENDIALL-----FLNGFIPWESPGVRAIPLAIKAPEE------GTTCLIHGWGKVTMKEKSA 190
            :|.:.|..||     :..|..             :|.||.      ...|...|||:...:|...
Mosquito   134 ATGDYDFGLLKLKQRYRRGTF-------------VKLPERRRRFPPAERCTAMGWGETLGRESRE 185

  Fly   191 SLQQAPVPILNKELCQVIY----KLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVG 251
            .|:|..:||:::.:|:..|    ::.|..:|||:.:|..|||.|||||||||.|..||:|||.:|
Mosquito   186 QLRQVVMPIVSQAVCRKAYEGTDEITARMLCAGYPEGMRDACDGDSGGPLICRGIQAGVISWAIG 250

  Fly   252 CADPGYPGVYTNVSHFLKWIR 272
            ||.|...|||::::...:|||
Mosquito   251 CAQPNKYGVYSSIAEGREWIR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 77/248 (31%)
Tryp_SPc 38..273 CDD:238113 80/250 (32%)
AgaP_AGAP010798XP_001231167.2 Tryp_SPc 49..270 CDD:214473 77/248 (31%)
Tryp_SPc 50..273 CDD:238113 80/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.