DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP010614

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_001237580.2 Gene:AgaP_AGAP010614 / 4577723 VectorBaseID:AGAP010614 Length:266 Species:Anopheles gambiae


Alignment Length:254 Identity:70/254 - (27%)
Similarity:113/254 - (44%) Gaps:49/254 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYR-- 99
            :||.|..|:|.:..:.:|:|...:.:        ||..:|:.....:||||         ||:  
Mosquito    36 RIVNGKAVSIVKYKYALSLRVNGVFD--------CGATIITNSHSLTAAHC---------VYKYP 83

  Fly   100 -DPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTL----ENDIALLF--LNGFIPWESP 157
             ||....:..||::   |.....|..|..|..|.:||....    :.|:|:|.  :|.|    |.
Mosquito    84 SDPSRVTLYGGSTS---TSSGGIEVPVVSIALHPNYNRKAFPAASDCDVAVLNVPVNSF----SG 141

  Fly   158 GVRAIPLAIKAPE--EGTTCLIHGWGKVTMKEKSASLQQ---APVPILNKELCQVIYKLPASQMC 217
            .....|||::..|  .||.|.:.|||: |...:.||:.|   |.:.|:::..|..::....:.:|
Mosquito   142 RPNMAPLALQTNELPVGTECFVIGWGR-TGNNQPASVNQLRYANMNIVSQSTCATMWAEYRNMIC 205

  Fly   218 AGFLQGGIDACQGDSGGPLICDGRLAGIIS---------WGVGCADPGYPGVYTNVSHF 267
            |.: ..|:|.|.|||||.|:|...|||::|         |..|.|....|.:.:.:..:
Mosquito   206 AKY-NNGVDTCGGDSGGALVCGSGLAGVVSFSHPNCTSAWPAGFAKITAPSIRSFIRQY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 70/254 (28%)
Tryp_SPc 38..273 CDD:238113 70/253 (28%)
AgaP_AGAP010614XP_001237580.2 Tryp_SPc 36..253 CDD:214473 69/242 (29%)
Tryp_SPc 37..262 CDD:238113 70/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.