DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP010619

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_001230717.2 Gene:AgaP_AGAP010619 / 4577722 VectorBaseID:AGAP010619 Length:280 Species:Anopheles gambiae


Alignment Length:293 Identity:74/293 - (25%)
Similarity:119/293 - (40%) Gaps:55/293 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MCLLIVATHSGITQSQIGQPTATASPFVILP--------------KIVGGYTVTIDQVPFQVSVR 56
            :||.    :|.:..:. |...|||...|::.              :|:.|:...|...||.:|||
Mosquito    10 LCLF----YSNVVSAN-GNEKATAEAAVLVKAENVTEAEAAAQSGRIINGFASDIANYPFAISVR 69

  Fly    57 RRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQ 121
            |..   :.|     |||.|||.        .||:..:.| ||.......:..||::.:.....  
Mosquito    70 RDG---QFY-----CGGTVISA--------SYALTAATP-VYPYRNSITLYGGSTSANSGGVL-- 115

  Fly   122 EYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPG----VRAIPLAIKAPEEGTTCLIHGWGK 182
             :.|..|..|..:|.:...:|..:..|.  :|..:.|    :..||||......||.|.:.|||:
Mosquito   116 -FKVLMIAVHLLFNPNDRVSDYNIAILT--VPANAFGGRRNIAPIPLASAEVAIGTKCTVFGWGR 177

  Fly   183 --VTMKEKSASLQQAPVPILNKELC-----QVIYKLPASQMCAGFLQGGIDACQGDSGGPLICDG 240
              ..:...:.:|:.|.:.|.:...|     .:..:|.::.:||..::|. |.|.||.|..|:|.|
Mosquito   178 TNANLPGPANALRSADMVISSGATCARAWGPLSVQLTSNMICAKGVRGA-DLCIGDYGNALVCRG 241

  Fly   241 RLAGIISWGVGCADPGYPGVYTNVSHFLKWIRR 273
            :|.||........|.....||..::.:.  |||
Mosquito   242 KLNGIAFLASPGCDNTRDSVYMRITEYN--IRR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 63/244 (26%)
Tryp_SPc 38..273 CDD:238113 64/245 (26%)
AgaP_AGAP010619XP_001230717.2 Tryp_SPc 50..268 CDD:214473 63/240 (26%)
Tryp_SPc 51..268 CDD:238113 63/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.