DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP004571

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_313875.2 Gene:AgaP_AGAP004571 / 4576898 VectorBaseID:AGAP004571 Length:324 Species:Anopheles gambiae


Alignment Length:262 Identity:91/262 - (34%)
Similarity:128/262 - (48%) Gaps:56/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC------YAINTSVP 95
            :||||....:::.|:   :.|.|...|.|     |||.:|:.|.|.:||||      :.|.    
Mosquito    82 RIVGGQATGVNEFPW---MARLSYFNRFY-----CGGMLINDRYVLTAAHCVKGFMWFMIK---- 134

  Fly    96 LVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVR 160
                     |.....:..|.:.|....::::.|.  :.::....:||||||.||..:| .:..:|
Mosquito   135 ---------VTFGEHNRCDDSVRPETRFVLRAIA--QKFSFLNFDNDIALLRLNDRVP-ITDFIR 187

  Fly   161 AIPLAIKAPEE------GTTCLIHGWGKVTMKE---KSASLQQAPVPILNKELCQVIYKLPAS-- 214
            .|.|    |.:      ||.....|||  |:||   .|..||:..||:|:.|:|.......||  
Mosquito   188 PICL----PSDPSNAYVGTNGTATGWG--TLKEDGKPSCILQEVEVPVLSNEVCSTQTNYTASMI 246

  Fly   215 ---QMCAGFL-QGGIDACQGDSGGPLICDG-----RLAGIISWGVGCADPGYPGVYTNVSHFLKW 270
               .:|||:| .|..|:||||||||||.:.     .|.|::|||.|||.|.||||||.|:.:|.|
Mosquito   247 TDNMLCAGYLGVGEKDSCQGDSGGPLIAEREDKRYELIGVVSWGNGCARPYYPGVYTRVTRYLDW 311

  Fly   271 IR 272
            ||
Mosquito   312 IR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 88/259 (34%)
Tryp_SPc 38..273 CDD:238113 91/261 (35%)
AgaP_AGAP004571XP_313875.2 Tryp_SPc 82..312 CDD:214473 88/259 (34%)
Tryp_SPc 83..315 CDD:238113 91/261 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.