DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP012492

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_001230278.2 Gene:AgaP_AGAP012492 / 4397588 VectorBaseID:AGAP012492 Length:266 Species:Anopheles gambiae


Alignment Length:236 Identity:73/236 - (30%)
Similarity:109/236 - (46%) Gaps:54/236 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC---YAINTSVPLVY 98
            :|:.|..|:|:...|.||:|   :..|:|     |||::||...|.||.||   :..|.|...:|
Mosquito    24 RIINGVPVSIEIYKFAVSLR---VDNRYY-----CGGSIISVSHVLSAGHCVYPFLTNVSRMSIY 80

  Fly    99 RDPELYVVVAGSSAIDRTDRFTQ--EYLVQRIVGHKDYNGS----TLENDIALL-----FLNGFI 152
                      |.|    |..|:.  ...|.|.|.|.|||.:    ..:.|:|:|     .|.|  
Mosquito    81 ----------GGS----TSPFSGGISIPVIRAVNHPDYNPNPPFGIHDFDVAVLTVPRNALRG-- 129

  Fly   153 PWESPGVRAIPLAIKAPE--EGTTCLIHGWGKVTMKEKS--ASLQQAPVPILNKELC-----QV- 207
               .|.:  .|:||:..:  .||.|.:.|||......::  ..|....:.|::::.|     || 
Mosquito   130 ---RPNM--APIAIQNVQIPAGTRCYVVGWGWTDFNARTNPTELHYLNMAIVSQDSCASAYSQVN 189

  Fly   208 IYKLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISW 248
            |:.:.::.:||...| |.|.|:||||..|:|.|||.||.|:
Mosquito   190 IWGINSNMICAKGNQ-GTDTCKGDSGSALVCGGRLTGISSF 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 73/236 (31%)
Tryp_SPc 38..273 CDD:238113 73/235 (31%)
AgaP_AGAP012492XP_001230278.2 Tryp_SPc 24..246 CDD:214473 73/236 (31%)
Tryp_SPc 25..229 CDD:238113 72/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.