DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and AgaP_AGAP012491

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:XP_001230277.2 Gene:AgaP_AGAP012491 / 4397584 VectorBaseID:AGAP012491 Length:272 Species:Anopheles gambiae


Alignment Length:254 Identity:74/254 - (29%)
Similarity:116/254 - (45%) Gaps:56/254 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHC---YAINTSVPLVY 98
            :||.|..|.|....:.:|:|        :....:||.::|:.....:||||   |...:|...:|
Mosquito    36 RIVNGIPVNISNYKYALSMR--------FDGEFICGASIITYSHALTAAHCVYNYQFMSSRLTLY 92

  Fly    99 RDPELYVVVAGS-SAIDRTDRFTQEYLVQRIVG---HKDY----NGSTLENDIALLFL--NGFIP 153
                     .|| ||......|.       :||   |..|    ..:|.:.|:|:|.:  |.|  
Mosquito    93 ---------GGSTSASSGGVEFP-------VVGGAIHPYYKPNSQSNTSDYDVAILNVPANSF-- 139

  Fly   154 WESPGVRAIPLAIKAPE--EGTTCLIHGWGKVTMKEKSASLQQ---APVPILNKELCQVIY---- 209
              |......|||::..|  .||.|.:.|||: |.:.:..|..|   |.:.|:::..|..::    
Mosquito   140 --SGRPNMAPLALQTKELPVGTRCFVVGWGR-TGENQPVSTNQLLYANMNIVSQSSCASMWANFE 201

  Fly   210 KLPAS---QMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVS 265
            ||.|.   .:||.: ..|:|.|:|||||.|:|.|||.|::|:|..|:.. :|.|:..|:
Mosquito   202 KLCAECKHMVCAQY-YNGMDTCRGDSGGALVCGGRLTGVVSFGPYCSGV-WPSVFAKVT 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 74/254 (29%)
Tryp_SPc 38..273 CDD:238113 74/253 (29%)
AgaP_AGAP012491XP_001230277.2 Tryp_SPc 36..266 CDD:214473 74/254 (29%)
Tryp_SPc 37..267 CDD:238113 74/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25744
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.