DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and KLK12

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:271 Identity:86/271 - (31%)
Similarity:125/271 - (46%) Gaps:53/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG 68
            |.:|:|      |::|:      ||       |||..|.....:..|:||.:        ..|..
Human     7 LLLCVL------GLSQA------AT-------PKIFNGTECGRNSQPWQVGL--------FEGTS 44

  Fly    69 HVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKD 133
            ..|||.:|..|.|.:||||            ....|.|..|..::.:.|...|.......|.|..
Human    45 LRCGGVLIDHRWVLTAAHC------------SGSRYWVRLGEHSLSQLDWTEQIRHSGFSVTHPG 97

  Fly   134 YNGSTL--ENDIALLFLNGFIPWE-SPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSA---SL 192
            |.|::.  |:|:.||.|.  :|.. :..|:.:||.......||.|.:.||| :|...::.   .|
Human    98 YLGASTSHEHDLRLLRLR--LPVRVTSSVQPLPLPNDCATAGTECHVSGWG-ITNHPRNPFPDLL 159

  Fly   193 QQAPVPILNKELCQVIY--KLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWG-VG-CA 253
            |...:.|::...|..:|  ::.::.:|||.:.|. |||||||||||:|.|.|.|::||| || |.
Human   160 QCLNLSIVSHATCHGVYPGRITSNMVCAGGVPGQ-DACQGDSGGPLVCGGVLQGLVSWGSVGPCG 223

  Fly   254 DPGYPGVYTNV 264
            ..|.|||||.:
Human   224 QDGIPGVYTYI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 78/238 (33%)
Tryp_SPc 38..273 CDD:238113 77/237 (32%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 78/238 (33%)
Tryp_SPc 22..236 CDD:238113 77/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.