DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and KLK14

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001298111.2 Gene:KLK14 / 43847 HGNCID:6362 Length:251 Species:Homo sapiens


Alignment Length:283 Identity:101/283 - (35%)
Similarity:140/283 - (49%) Gaps:56/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MCLLIVATH---SGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSV----RRRSIHER 63
            |.||:.|..   ..:||||..:           .||:||:|.|....|:|.::    |||     
Human     1 MFLLLTALQVLAIAMTQSQEDE-----------NKIIGGHTCTRSSQPWQAALLAGPRRR----- 49

  Fly    64 HYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRI 128
                 .:||||::|.:.|.:||||     ..|::.       |..|...:.|.:...|...|.|.
Human    50 -----FLCGGALLSGQWVITAAHC-----GRPILQ-------VALGKHNLRRWEATQQVLRVVRQ 97

  Fly   129 VGHKDYNGSTLENDIALLFLNGFIPWESP-----GVRAIPLAIKAPEEGTTCLIHGWGKVT--MK 186
            |.|.:||..|.:||:.||.|      :.|     .||.|.:.......||:|.:.|||.::  :.
Human    98 VTHPNYNSRTHDNDLMLLQL------QQPARIGRAVRPIEVTQACASPGTSCRVSGWGTISSPIA 156

  Fly   187 EKSASLQQAPVPILNKELCQVIY--KLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWG 249
            ...||||...:.|...|:||..|  .:....:|||..|||.|:|||||||||:|.|:|.|::|||
Human   157 RYPASLQCVNINISPDEVCQKAYPRTITPGMVCAGVPQGGKDSCQGDSGGPLVCRGQLQGLVSWG 221

  Fly   250 V-GCADPGYPGVYTNVSHFLKWI 271
            : .||.|||||||||:..:..||
Human   222 MERCALPGYPGVYTNLCKYRSWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 91/247 (37%)
Tryp_SPc 38..273 CDD:238113 92/248 (37%)
KLK14NP_001298111.2 Tryp_SPc 25..247 CDD:238113 92/248 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.