DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG34130

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:222 Identity:46/222 - (20%)
Similarity:92/222 - (41%) Gaps:40/222 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 VCGGAVISQRVVCSAAHC------YAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRI 128
            |||.:.:|.....::|:|      ...:.||.||..|..      ..:.:|..|  ....|::.|
  Fly    68 VCGASYLSALYALTSANCMHSHRSQMESLSVELVSSDSR------QDNQLDSHD--PPNALIRNI 124

  Fly   129 VGHKDYNGSTLENDIALLFL--------NGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTM 185
            :..||::......|:|::.|        |.::.     :...||   :..:..:.:.:|.|    
  Fly   125 IVSKDWHWPGTFMDVAVIELTNRLRGNRNNYVT-----LCTNPL---SSYKSLSVVSYGAG---- 177

  Fly   186 KEKSASLQQAPVPILNKELCQVIY---KLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIIS 247
              .:.:::...:.:||:.:|...|   .|..:..||...:...| |...:|.|:....:|.||::
  Fly   178 --PAENVRTEEIEVLNRMICDSAYGNFLLRETVACAKEFKRSAD-CMFSAGCPVTAGDQLCGIVA 239

  Fly   248 WGVGCADPGYPGVYTNVSHFLKWIRRA 274
            |...|.....||::|::....::|.:|
  Fly   240 WSPACKRSNLPGIFTDIHQVKRFILKA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 44/217 (20%)
Tryp_SPc 38..273 CDD:238113 45/219 (21%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 44/217 (20%)
Tryp_SPc 53..256 CDD:304450 44/210 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.