DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:293 Identity:80/293 - (27%)
Similarity:121/293 - (41%) Gaps:48/293 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWMCLLIVATHSGITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG 68
            :::.|.:.|..:....:|...||....   |..:|..||.....:||:.|.:       ...|.|
  Fly     5 VFLALAVAAATAVPAPAQKLTPTPIKD---IQGRITNGYPAYEGKVPYIVGL-------LFSGNG 59

  Fly    69 H-VCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHK 132
            : .|||::|....|.:||||....:.|.:.|           .::|....::|.......|:.|.
  Fly    60 NWWCGGSIIGNTWVLTAAHCTNGASGVTINY-----------GASIRTQPQYTHWVGSGDIIQHH 113

  Fly   133 DYNGSTLENDIALLFLNGFIPWESPGVRAIPLA--IKAPE--------EGTTCLIHGWGKVTMKE 187
            .||...|.|||:|:        .:|.|....|.  ::.|.        .|...:..|||......
  Fly   114 HYNSGNLHNDISLI--------RTPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGGTYDGS 170

  Fly   188 KSAS-LQQAPVPILNKELCQVIYKLPASQMCAGFLQGGIDACQGDSGGPLIC-DG-RLAGIISWG 249
            .... ||...|.|:::..|...:.|..:.:|.. ..||...|.|||||||:. || ||.|:.|:|
  Fly   171 PLPDWLQSVDVQIISQSDCSRTWSLHDNMICIN-TDGGKSTCGGDSGGPLVTHDGNRLVGVTSFG 234

  Fly   250 --VGCADPGYPGVYTNVSHFLKWIRRANASLDY 280
              .|| ..|.|.|::.|:.:|.|| |.|..:.|
  Fly   235 SAAGC-QSGAPAVFSRVTGYLDWI-RDNTGISY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 69/249 (28%)
Tryp_SPc 38..273 CDD:238113 71/250 (28%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 72/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.