DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG11842

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:271 Identity:70/271 - (25%)
Similarity:114/271 - (42%) Gaps:60/271 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGH---------VCGGAVISQRVVCSAAHCYAIN 91
            |.|:||......:.|....            |||         .|||.:||.|.|.:||||    
  Fly    71 PLIIGGGPAVPKEFPHAAR------------LGHKDENGEVEWFCGGTLISDRHVLTAAHC---- 119

  Fly    92 TSVPLVYRDPELYVVVA--GSSAID--RTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLN--- 149
                  :..|:..|.:|  |....|  ..|...:::.|:....|.:::...:.|||:::.|:   
  Fly   120 ------HYSPQGSVNIARLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPV 178

  Fly   150 GFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKSASLQQAPVPILN-KELCQVIY---- 209
            .|..::.|..    |.......||:.:..|||::.:..::.:.:...|.:.| ...|::..    
  Fly   179 TFNDYKHPAC----LPFDDGRLGTSFIAIGWGQLEIVPRTENKKLQKVKLYNYGTRCRITADRND 239

  Fly   210 KLP-----ASQMCAGFLQGGIDACQGDSGGPLI-------CDGRLAGIISWGVGCADPGYPGVYT 262
            :||     .:|:|.|..:.. |.|.||||||::       |...:.||.|.||.|..|..|.:||
  Fly   240 ELPEGYNATTQLCIGSNEHK-DTCNGDSGGPVLIYHMDYPCMYHVMGITSIGVACDTPDLPAMYT 303

  Fly   263 NVSHFLKWIRR 273
            .|..:|.||::
  Fly   304 RVHFYLDWIKQ 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 67/266 (25%)
Tryp_SPc 38..273 CDD:238113 69/267 (26%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 69/269 (26%)
Tryp_SPc 73..312 CDD:214473 67/265 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.