DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG7142

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:262 Identity:82/262 - (31%)
Similarity:120/262 - (45%) Gaps:40/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            |.:.....|....|:.||::..:..:   ||.|.|.|.:|::..:.:||||.:...:|       
  Fly    79 KFLAKREATPHSAPYVVSIQMMTPDQ---GLVHYCAGTIINEHWILTAAHCLSSPQAV------- 133

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRI---VGHKDYNGSTLENDIALLFLNG---FIPWESPGVR 160
            |..|:||||..|...........::.|   |.|:.|.|.....||||::...   |..:..|.  
  Fly   134 ENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPA-- 196

  Fly   161 AIPLAIKAPE-EGTTCLIHGWGKVTM---KEKSASLQQAPVPILNKELCQVI-----YKLPASQM 216
            .:|.....|| .||   ::|||.|:|   ......||:|.:|||:.|||:.|     ..|..:.:
  Fly   197 TLPEQDAQPEGYGT---LYGWGNVSMTAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNL 258

  Fly   217 CAGFLQGGIDACQGDSGGPLI---CDGR------LAGIISWG-VGCADPGYPGVYTNVSHFLKWI 271
            |.|.|.||:..|..|||||||   |:..      :.||:||| :.|.....|.|:..||.|.:||
  Fly   259 CTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSWGKMPCGQKNAPSVFVRVSAFTEWI 323

  Fly   272 RR 273
            .:
  Fly   324 NQ 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 80/258 (31%)
Tryp_SPc 38..273 CDD:238113 81/259 (31%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 81/257 (32%)
Tryp_SPc 84..323 CDD:214473 79/253 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455602
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.