DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG5255

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:277 Identity:82/277 - (29%)
Similarity:137/277 - (49%) Gaps:42/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TATASPFVILP------KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG---HVCGGAVISQRVV 81
            |::|:..::.|      :||||........|:|:|::         |:|   |.||||:|.:|.:
  Fly    12 TSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQ---------GIGSGAHSCGGAIIDERWI 67

  Fly    82 CSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALL 146
            .:||||..        .|....:.|:.|:.  |.....::.|...|||.|.:|......||||||
  Fly    68 ITAAHCTR--------GRQATAFRVLTGTQ--DLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALL 122

  Fly   147 FLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTM-KEKSASLQQAPVPILNKELCQVIY- 209
            .||..|.::: ..:.:.|..:|...|:..|:.|||.::: .:..|.||...|..:..|.|:..: 
  Fly   123 HLNESIVFDN-ATQPVELDHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHD 186

  Fly   210 ---KLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWI 271
               ::....:|. |...|..||.|||||||:.:|:|..:::||:.|| .|||..:.::|::..:|
  Fly   187 NSTRVDIGHVCT-FNDKGRGACHGDSGGPLVHNGKLVALVNWGLPCA-KGYPDAHASISYYHDFI 249

  Fly   272 R------RANASLDYSE 282
            |      :.::|.|..|
  Fly   250 RTHLSLSKTDSSEDIEE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 74/241 (31%)
Tryp_SPc 38..273 CDD:238113 76/248 (31%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 74/241 (31%)
Tryp_SPc 30..252 CDD:238113 76/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.