DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG5246

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:245 Identity:76/245 - (31%)
Similarity:119/245 - (48%) Gaps:30/245 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :::||........|:|||:...      :| .|||||::|:.:.:.:||||    ...|:.|   
  Fly    41 RVIGGVDSPTGFAPYQVSIMNT------FG-EHVCGGSIIAPQWILTAAHC----MEWPIQY--- 91

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAI 166
              ..:|.|:  :|.| |...||||.....|..::.....|||||:.....|.::.. .:.|.||.
  Fly    92 --LKIVTGT--VDYT-RPGAEYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDL-TQPIKLAS 150

  Fly   167 KA--PEEGTTCLIHGWGKV-TMKEKSASLQQAPVPILNKELCQVIYK----LPASQMCAGFLQGG 224
            |.  |:.|....:.|||.. |....|..||:..:..::.:.||...:    |....:|. |.|.|
  Fly   151 KGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGHVCT-FTQEG 214

  Fly   225 IDACQGDSGGPLI-CDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWIRR 273
            ..:|.|||||||: .:..|.|:::||..|| .|||.|:.:|:::..||.:
  Fly   215 EGSCHGDSGGPLVDANQTLVGVVNWGEACA-IGYPDVFGSVAYYHDWIEQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 74/241 (31%)
Tryp_SPc 38..273 CDD:238113 76/242 (31%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 74/241 (31%)
Tryp_SPc 42..263 CDD:238113 76/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.