DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG31266

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:249 Identity:80/249 - (32%)
Similarity:112/249 - (44%) Gaps:39/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :::||.|......|:..|::....:       |:||..::.:..|.:||.|.|....:.|     
  Fly    51 RVIGGTTAAEGNWPWIASIQNAYSY-------HLCGAIILDETWVLTAASCVAGLRPLNL----- 103

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLA- 165
               :||.|:  :|..|.:...|.|.:|..|.:::.....||||||.|:..|.:... .:.|.|| 
  Fly   104 ---LVVTGT--VDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDV-TKNITLAD 162

  Fly   166 IKAPEEGTTCLIHGWG-KVTMKEKSASLQQAPVPILNKELCQVIYKLP----------ASQMCAG 219
            |...|||......||| ...|......||:|....|..:.|:  .||.          ..||.||
  Fly   163 IDELEEGDKLTFAGWGSSEAMGTYGRYLQEASGTYLPVDACR--EKLQNQDDVDLGHVCVQMDAG 225

  Fly   220 FLQGGIDACQGDSGGPLICD-GRLAGIISWGVGCADPGYPGVYTNVSHFLKWIR 272
              ||   ||.||:|||||.: .||.||.:|||.|. .|||.||...:.:..|||
  Fly   226 --QG---ACHGDTGGPLIDEQQRLVGIGNWGVPCG-RGYPDVYARTAFYHDWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 77/246 (31%)
Tryp_SPc 38..273 CDD:238113 80/248 (32%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 77/246 (31%)
Tryp_SPc 52..275 CDD:238113 80/248 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439391
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.