DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG31265

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:287 Identity:79/287 - (27%)
Similarity:126/287 - (43%) Gaps:47/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDHLWMCLLIVATHSGITQSQIGQPTATASPFVILP-------KIVGGYTVTIDQVPFQVSVRRR 58
            |..|.:.|||:..        :..|....|..::.|       :|.||....|...|:|||:   
  Fly     1 MKLLRLSLLILLA--------VKPPNPCESKRIVGPFPAGQSGRIKGGEEAEIGFAPYQVSL--- 54

  Fly    59 SIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQE- 122
               :...| .|.||||::::..:.:|.||  :...:      |.|..|:.|      |:::.:. 
  Fly    55 ---QPIVG-SHNCGGAILNENWIITAGHC--VENFI------PALVNVITG------TNKWAEPG 101

  Fly   123 --YLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGK-VT 184
              |....|..|..|:...:.|||||:.|...|.:... .:.|.|..:..:.|...::.|||. |.
  Fly   102 AIYYTAEIHKHCMYDQPYMHNDIALVKLTENITFNEL-TQPIALPTRPVQLGEEIVLTGWGSDVA 165

  Fly   185 MKEKSASLQQAPVPILNKELCQVIYKLPAS----QMCAGFLQGGIDACQGDSGGPLICDGRLAGI 245
            .......|.:..|.::..:.|...:...:|    .:|. |.:.|..||.|||||||:.:|:|.|:
  Fly   166 YGSSMEDLHKLTVGLVPLDECYETFNRTSSMGVGHICT-FSREGEGACHGDSGGPLVSNGQLVGV 229

  Fly   246 ISWGVGCADPGYPGVYTNVSHFLKWIR 272
            ::||..|. .|.|.|..||.::|.|||
  Fly   230 VNWGRPCG-VGLPDVQANVYYYLDWIR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 68/241 (28%)
Tryp_SPc 38..273 CDD:238113 71/243 (29%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 68/241 (28%)
Tryp_SPc 39..257 CDD:238113 70/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.