DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG17477

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:252 Identity:79/252 - (31%)
Similarity:114/252 - (45%) Gaps:45/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IVGGYTVTIDQVPFQVSVRRRSIHERHYGLG-HVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            ||||........|:|||::..        || |:||||:||.|.:.:|.||..       .|...
  Fly    27 IVGGQNAAEGDAPYQVSLQTL--------LGSHLCGGAIISDRWIITAGHCVK-------GYPTS 76

  Fly   102 ELYVVVAGSSAIDRTDRFTQE---YLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIP 163
            .|.|...       |.|:.:.   |....|..|.:|:....:|||.||.||     ||....|:.
  Fly    77 RLQVATG-------TIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLN-----ESITFNALT 129

  Fly   164 LAIKAP----EEGTTCLIH-GWGKVTMKEKSAS-LQQAPVPILNKELCQVI------YKLPASQM 216
            .|::.|    ..|.:.|:. |||..:......| ||:.....||...|:.:      .:|....:
  Fly   130 QAVELPTSPFPRGASELVFTGWGSQSAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHI 194

  Fly   217 CAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSHFLKWIRR 273
            || :.|..|.||.|||||||:..|.|.||:::.|.||. |.|.::.|:.::..|:|:
  Fly   195 CA-YRQANIGACHGDSGGPLVHQGTLVGILNFFVPCAQ-GVPDIFMNIMYYRDWMRQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 77/248 (31%)
Tryp_SPc 38..273 CDD:238113 78/250 (31%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 79/252 (31%)
Tryp_SPc 27..246 CDD:214473 77/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.