DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and CG10405

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:254 Identity:83/254 - (32%)
Similarity:124/254 - (48%) Gaps:44/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KIVGGYTVTIDQVPFQVSVRRRSIHERHYGLGHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDP 101
            :||.|...|..|.|:|:|:||:::        |:||.:::|.....:||||      :....:.|
  Fly    36 RIVNGREATEGQFPYQLSLRRQTV--------HICGASILSSNWAITAAHC------IDGHEQQP 86

  Fly   102 ELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAI 166
            ..:.:..||  |.||...|.: .|:.|..|..|:.:.:..|:|||       ..:.|..::||..
  Fly    87 REFTLRQGS--IMRTSGGTVQ-PVKAIYKHPAYDRADMNFDVALL-------RTADGALSLPLGK 141

  Fly   167 KAP----------EEGTTCLIHGWGKVTMKEK--SASLQQAPVPILNKELCQVIYK----LPASQ 215
            .||          .|....::.|||.::....  |:.|:...|..:|:|.|....:    :..:.
  Fly   142 VAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRHHGGVTEAM 206

  Fly   216 MCAGFLQGGIDACQGDSGGPLICDGRLAGIISWGVGCADPGYPGVYTNVSH--FLKWIR 272
            .||.  ....||||||||||:...|.|.||:|||||||||.||||||.::|  ..:|||
  Fly   207 FCAA--ARNTDACQGDSGGPISAQGTLIGIVSWGVGCADPYYPGVYTRLAHPTIRRWIR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 80/251 (32%)
Tryp_SPc 38..273 CDD:238113 83/253 (33%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 80/251 (32%)
Tryp_SPc 37..263 CDD:238113 81/251 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.