DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32755 and Sb

DIOPT Version :9

Sequence 1:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_001287355.1 Gene:Sb / 41958 FlyBaseID:FBgn0003319 Length:787 Species:Drosophila melanogaster


Alignment Length:276 Identity:96/276 - (34%)
Similarity:138/276 - (50%) Gaps:45/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGLG--HVCGGAVISQRVV 81
            :|:.|.|| .|.|..   :||||.:....:.|:||||||.|.    :|..  |.||||:|::..:
  Fly   529 RSECGVPT-LARPET---RIVGGKSAAFGRWPWQVSVRRTSF----FGFSSTHRCGGALINENWI 585

  Fly    82 CSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQEYLVQRIVGHKDYNGSTLENDIALL 146
            .:|.||..     .|:.....:.|.....|.:.....:.:..:.:::| |..|:..|.|.|:||:
  Fly   586 ATAGHCVD-----DLLISQIRIRVGEYDFSHVQEQLPYIERGVAKKVV-HPKYSFLTYEYDLALV 644

  Fly   147 FLN---GFIPWESPGVRAIPLAIKAPEE-----GTTCLIHGWGKVTMKEKSAS-LQQAPVPILNK 202
            .|.   .|.|..||        |..||.     |....:.|||:::......| ||:..|||::.
  Fly   645 KLEQPLEFAPHVSP--------ICLPETDSLLIGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSN 701

  Fly   203 ELCQVIYK-------LPASQMCAGFLQGGIDACQGDSGGPLIC---DGR--LAGIISWGVGCADP 255
            :.|:.::.       :|...:|||:..||.|:|||||||||..   |||  ||||||||:|||:.
  Fly   702 DNCKSMFMRAGRQEFIPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEA 766

  Fly   256 GYPGVYTNVSHFLKWI 271
            ..|||.|.:|.|..||
  Fly   767 NLPGVCTRISKFTPWI 782

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 88/256 (34%)
Tryp_SPc 38..273 CDD:238113 90/257 (35%)
SbNP_001287355.1 Tryp_SPc 543..782 CDD:214473 88/256 (34%)
Tryp_SPc 544..785 CDD:238113 90/257 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.